Overview

  • Product name

    Recombinant Human FPR1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWV AGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKF VFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTV RGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAF FLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
    • Amino acids

      1 to 350
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • fMet Leu Phe receptor
    • fMet-Leu-Phe receptor
    • FMLP
    • fMLP receptor
    • FMLPR
    • Formyl peptide receptor 1
    • FPR
    • FPR 1
    • FPR receptor
    • FPR1
    • FPR1_HUMAN
    • N formyl peptide chemoattractant receptor
    • N formyl peptide receptor
    • N formylpeptide chemoattractant receptor
    • N-formyl peptide receptor
    • N-formylpeptide chemoattractant receptor
    see all
  • Function

    High affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity

    Neutrophils.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Phosphorylated; which is necessary for desensitization.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab158465 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up