Description

  • Product name

    Recombinant Human FRA10AC1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQ VAAELLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGE
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as C10orf4.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C10orf4
    • Chromosome 10 open reading frame 4
    • F26C11.1 like
    • FRA10AC1
    • FRA10AC1 protein
    • Fragile site 10q23.3
    • PRO2972
    • Protein FRA10AC1
    • Rare folic acid type fragile site FRA(10)(q23.3) candidate gene 1
    see all
  • Relevance

    The function of the FRA10AC1 protein is unknown. Expansion of a polymorphic CGG repeat within the 5'-UTR of the FRA10AC1 gene may be the cause of folate-sensitive fragile site FRA10A expression. Fragile sites appear visually as nonstaining gaps on chromosomes that are inducible by specific cell culture conditions.
  • Cellular localization

    Nuclear

Images

  • ab165150 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up