Description

  • Product name

    Recombinant Human Fragilis protein
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 133

Specifications

Our Abpromise guarantee covers the use of ab92921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, PBS, pH 7.4

General Info

  • Alternative names

    • 1 8U
    • Fragilis
    • IFITM3
    • IFM3_HUMAN
    • Interferon Induced Transmembrane Protein 3
    • Interferon induced transmembrane protein 3 (1 8U)
    • Interferon inducible
    • Interferon inducible protein 1 8U
    • Interferon Inducible Protein 15
    • Interferon Inducible Protein Homolog
    • Interferon-induced transmembrane protein 3
    • Interferon-inducible protein 1-8U
    • IP15
    see all
  • Function

    IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus (WNV), by inhibiting the early step(s) of replication.
  • Sequence similarities

    Belongs to the CD225 family.
  • Post-translational
    modifications

    Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab92921 on 10% SDS-PAGE stained with Coomassie Blue. Predicted band size is 43 kDa.

References

ab92921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up