Recombinant Human Frizzled 2/FZD2 protein (ab191625)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/g
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Frizzled 2/FZD2 protein
See all Frizzled 2/FZD2 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/g -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEV HQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEA LMNKFGFQWPERLRCEHFPRHGAEQICVGQNHS -
Predicted molecular weight
42 kDa including tags -
Amino acids
24 to 156 -
Additional sequence information
Fused with Fc fragment of Human IgG1 at the C terminus
-
Specifications
Our Abpromise guarantee covers the use of ab191625 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as Frizzled 2
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, Sodium chloride, L-Arginine
Lyophilized from 0.22 µm filtered solution. Normally trehalose is added as protectant before lyophilization. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Frizzled homolog 2
- Frizzled-2
- Frizzled2
see all -
Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. -
Tissue specificity
Widely expressed. In the adult, mainly found in heart, placenta, skeletal muscle, lung, kidney, pancreas, prostate, testis, ovary and colon. In the fetus, expressed in brain, lung and kidney. Low levels in fetal liver. -
Sequence similarities
Belongs to the G-protein coupled receptor Fz/Smo family.
Contains 1 FZ (frizzled) domain. -
Domain
Lys-Thr-X-X-X-Trp motif is involved in the activation of the Wnt/beta-catenin signaling pathway.
The FZ domain is involved in binding with Wnt ligands. -
Cellular localization
Membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab191625 has not yet been referenced specifically in any publications.