Overview

  • Product name

    Recombinant Human Frizzled 5 protein (Fc Chimera)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEI QCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKP
    • Molecular weight

      43 kDa including tags
    • Amino acids

      27 to 167
    • Additional sequence information

      Fused with a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab219684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C2orf31
    • DKFZP434E2135
    • Frizzled 5 seven transmembrane spanning receptor
    • Frizzled class receptor 5
    • Frizzled family receptor 5
    • Frizzled homolog 5
    • Frizzled-5
    • Frizzled5
    • Fz 5
    • Fz-5
    • Fz5
    • FZD 5
    • fzd5
    • FZD5_HUMAN
    • FzE 5
    • FzE5
    • HFZ 5
    • hFz5
    • MGC129692
    • Seven transmembrane receptor frizzled 5
    • Uncharacterized protein C2orf31
    • Wnt receptor
    see all
  • Function

    Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Interacts specifically with Wnt5A to induce the beta-catenin pathway.
  • Sequence similarities

    Belongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • Domain

    The PDZ-binding motif mediates interaction with GOPC.
    Lys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
    The FZ domain is involved in binding with Wnt ligands.
  • Cellular localization

    Cell membrane. Golgi apparatus membrane. Localized at the plasma membrane and also found at the Golgi.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219684 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 55-60 kDa in SDS-PAGE due to glycosylation.

References

ab219684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up