Recombinant Human Frizzled 7 protein (ab191958)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human Frizzled 7 protein -
Purity
> 92 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLE VHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCE ALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTA PYL -
Predicted molecular weight
43 kDa including tags -
Amino acids
33 to 185 -
Additional sequence information
Fused with Fc fragment of Human IgG1 at the C-terminus (AAH15915).
-
Specifications
Our Abpromise guarantee covers the use of ab191958 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.75% Glycine, 0.61% Tris, Sodium chloride, L-Arginine
Lyophilized from 0.22 µm filtered solution. Normally trehalose is added as protectant before lyophilization. -
ReconstitutionIt is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- Frizzled 7, seven transmembrane spanning receptor
- frizzled class receptor 7
- Frizzled drosophila homolog of 7
see all -
Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. -
Tissue specificity
High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas. -
Sequence similarities
Belongs to the G-protein coupled receptor Fz/Smo family.
Contains 1 FZ (frizzled) domain. -
Domain
Lys-Thr-X-X-X-Trp motif is involved in the activation of the Wnt/beta-catenin signaling pathway.
The FZ domain is involved in binding with Wnt ligands. -
Cellular localization
Membrane. - Information by UniProt
Images
Datasheets and documents
References
ab191958 has not yet been referenced specifically in any publications.