Overview

  • Product name

    Recombinant Human Frizzled homolog 1 protein (Fc Chimera)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIP LCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSM YAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHG AGELCVGQNTSDKGTPTPSLLPEFWTSNPQHIEGRMDPKSCDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK
    • Molecular weight

      46 kDa including tags
    • Amino acids

      73 to 253
    • Additional sequence information

      Recombinant fragment of Human Frizzled homolog 1, amino acids 73-253, fused at C terminal with Fc portion of Human IgG1 (amino acids 100-330).

Specifications

Our Abpromise guarantee covers the use of ab198659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.48% Tris, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    Sterile-filtered (0.2 µm) solution

General Info

  • Alternative names

    • Chfz-1
    • Dfrizzled-1
    • DKFZp564G072
    • FLJ95923
    • Frizzled 1
    • Frizzled homolog 1
    • Frizzled homolog 1 (Drosophila)
    • Frizzled-1
    • Fz receptor 1
    • Fz-1
    • Fz1
    • FZD1
    • FZD1_HUMAN
    • FzE1
    • hFz1
    • Rfz1
    • Wnt receptor
    • Xfrizzled-1
    see all
  • Function

    Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activated by Wnt3A, Wnt3, Wnt1 and to a lesser extent Wnt2, but not by Wnt4, Wnt5A, Wnt5B, Wnt6, Wnt7A or Wnt7B.
  • Tissue specificity

    Expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney.
  • Sequence similarities

    Belongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • Domain

    Lys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
    The FZ domain is involved in binding with Wnt ligands.
  • Cellular localization

    Membrane. Cell membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198659 (2 μg) with Coomassie staining.

    Note:  This protein runs at a higher apparent M.W. by SDS-PAGE due to glycosylation.

References

ab198659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up