Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVAL FDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYI PSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKG EFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGL CVKLGKPCLKIQVPAPFDLSYKTVDQWEIDHNSIQLLKRLGSGQFGEVWE GLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLED PIYIITELVRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNY IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWT APEAIRSNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNY RLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDYFETDSSYSDA NNFIR
    • Molecular weight

      81 kDa including tags
    • Amino acids

      1 to 505

Specifications

Our Abpromise guarantee covers the use of ab131807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta cell Src homology tyrosine kinase
    • BSK
    • BSK/IYK
    • C85044
    • Frk
    • Frk fyn related kinase
    • FRK_HUMAN
    • FYN related kinase
    • FYN-related kinase
    • GASK
    • Gastrointestinal associated kinase
    • Gastrointestinal associated tyrosine kinase
    • GTK
    • GTK, mouse, homolog of
    • Intestine tyrosine kinase
    • Nuclear tyrosine protein kinase RAK
    • Protein-tyrosine kinase 5
    • PTK5
    • PTK5 protein tyrosine kinase 5
    • RAK
    • Tyrosine protein kinase FRK
    • Tyrosine-protein kinase FRK
    see all
  • Function

    Positively regulates PTEN protein stability through phosphorylation of PTEN on 'Tyr-336', which in turn prevents its ubiquitination and degradation possibly by reducing its binding to NEDD4. May function as a tumor suppressor.
  • Tissue specificity

    Restricted to cells lines derived from tissues of lymphoid, brain, breast, colon and bladder origin.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131807 stained with Coomassie Blue.

References

ab131807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up