Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYS LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEP LKIKEELTRYLLYLQIKRDIFHGHLLCSFSDAAYLGACIVQAELGDYDPN EHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHT LETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKF EGKTFYVIGTQKEKKAMLAFNTSTPAACKHLWKCGVENQAFYKYAKSSQI KTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANITQSRSS HSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSS PVKAAREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDML FDCPSRLELEREDTDSFEDLEADENAFLIAEEEELKEARRALSWSYDILT GHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLCEIRQTP EFEQFHYEYYCPLKEWVAGKVHLILYMLGCS
    • Amino acids
      1 to 581
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4.1O
    • Band 4.1 like protein 4O
    • Band 4.1-Like Protein
    • EPB41L4O
    • EPB41LO
    • FERM Domain Containing 3
    • FERM domain containing protein 3
    • Ovary type protein 4.1
    • P410
    • Protein 4.1O
    see all
  • Relevance
    FRMD3 is a multifunctional protein essential for maintaining erythrocyte shape and membrane mechanical properties. Is a putative tumor suppressor gene. 5 different isoforms generated by alternative splicing have been described.
  • Cellular localization
    Cytoplasm; cytoskeleton. Plasma membrane.

Images

  • ab166071 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up