Description

  • Product name

    Recombinant Human FRS2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTR KRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNM LQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGY PRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTT GVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVK FVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTV PASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTR HNSTDLPMLAWK
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      1 to 512
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FGFR signaling adaptor SNT
    • FGFR signalling adaptor
    • FGFR substrate 2
    • FGFR-signaling adaptor SNT
    • Fibroblast growth factor receptor substrate 2
    • FRS 2
    • FRS2
    • FRS2_HUMAN
    • FRS2A
    • FRS2alpha
    • SNT
    • SNT 1
    • SNT-1
    • SNT1
    • Suc 1 Associated Neurotrophic Factor Target
    • Suc1 associated neurotrophic factor target 1
    • Suc1-associated neurotrophic factor target 1
    see all
  • Function

    Adapter protein that links FGR and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.
  • Tissue specificity

    Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis.
  • Sequence similarities

    Contains 1 IRS-type PTB domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues upon stimulation by NGF.
    Ubiquitinated when tyrosine phosphorylated and in a complex with GRB2. The unphosphorylated form is not subject to ubiquitination.
  • Cellular localization

    Endomembrane system. Cytoplasmic, membrane-bound.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab132038 at approximately 82.72 kDa.
    Stained with Coomassie Blue.

References

ab132038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up