Recombinant Human FSBP protein (denatured) (ab156713)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVGKARSSNFTLSEKLDLLKLVKPYVK ILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDRPPRTAQGLRTLYKRLKE YAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQSAN LDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLE QREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRS LLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRA KIEVEKLKAIRLRHDLPEYNSL
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 299
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 6% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Fibrinogen silencer binding protein
  • Cellular localization

    Nuclear

Images

  • 15% SDS-PAGE analysis of ab156713 (3µg).

References

ab156713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up