Overview

  • Product name
    Recombinant Human FSH beta protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKT CTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLG PSYCSFGEMKE
    • Amino acids
      19 to 129
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Follicle Stimulating Hormone
    • Follicle stimulating hormone beta polypeptide
    • Follicle stimulating hormone beta subunit
    • Follitropin beta chain
    • Follitropin subunit beta
    • FSH-B
    • FSH-beta
    • FSHB
    • FSHbeta
    see all
  • Relevance
    Follicle stimulating hormone enables ovarian folliculogenesis to the antral follicle stage and is essential for Sertoli cell proliferation and maintenance of sperm quality in the testis. Members of the pituitary glycoprotein hormone family, of which FSH is one consist of a shared alpha chain and a beta chain encoded by a separate gene. The FSH beta gene encodes the beta subunit of follicle stimulating hormone.
  • Cellular localization
    Secreted

Images

  • ab158468 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up