Recombinant Human FSH-R protein (His tag) (ab267964)
Key features and details
- Expression system: Mammalian
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human FSH-R protein (His tag) -
Purity
> 85 % SDS-PAGE. -
Expression system
Mammalian -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFS GFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQ NLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVG LSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGA SGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEA SLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAED NESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR -
Predicted molecular weight
78 kDa -
Amino acids
18 to 366 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab267964 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), 0.1576% Tris HCl, 0.029% EDTA
Liquid from.
General Info
-
Alternative names
- Follicle stimulating hormone receptor
- Follicle stimulating hormone receptor isoform 1
- Follicle-stimulating hormone receptor
see all -
Function
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. -
Tissue specificity
Sertoli cells and ovarian granulosa cells. -
Involvement in disease
Defects in FSHR are a cause of ovarian dysgenesis type 1 (ODG1) [MIM:233300]; also known as premature ovarian failure or gonadal dysgenesis XX type or XX gonadal dysgenesis (XXGD) or hereditary hypergonadotropic ovarian failure or hypergonadotropic ovarian dysgenesis with normal karyotype. ODG1 is an autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).
Defects in FSHR are a cause of ovarian hyperstimulation syndrome (OHSS) [MIM:608115]. OHSS is a disorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.
Contains 9 LRR (leucine-rich) repeats.
Contains 1 LRRNT domain. -
Post-translational
modificationsN-glycosylated; indirectly required for FSH-binding, possibly via a conformational change that allows high affinity binding of hormone. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab267964 has not yet been referenced specifically in any publications.