Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLK FVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLK CLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGK NQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTKEI
    • Molecular weight
      34 kDa including tags
    • Amino acids
      21 to 308
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab173042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µm Ø filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.

General Info

  • Alternative names
    • Anti FSTL1
    • FLJ50214
    • FLJ52277
    • Follistatin like 1
    • Follistatin related protein
    • Follistatin-like protein 1
    • Follistatin-related protein 1
    • FRP
    • FSL1
    • FSTL1
    • FSTL1 antibody
    • FSTL1_HUMAN
    • Micro RNA 198
    • MIR198
    • miRNA198 included
    • OCC 1
    • OCC1
    see all
  • Function
    May modulate the action of some growth factors on cell proliferation and differentiation. Binds heparin.
  • Tissue specificity
    Overexpressed in synovial tissues from rheumatoid arthritis.
  • Sequence similarities
    Contains 2 EF-hand domains.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
    Contains 1 VWFC domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab173042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up