Description

  • Product name

    Recombinant Human FSTL1/FRP protein
    See all FSTL1/FRP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLK FVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLK CLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGK NQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTKEIHHHHHH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      21 to 308
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 21 to 308. The signal peptide is not included

Specifications

Our Abpromise guarantee covers the use of ab191942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

     This product was previously labelled as FSTL1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Dissolve lyophilized protein in 1XPBS to a concentration no less than 100ug/ml.

General Info

  • Alternative names

    • Anti FSTL1
    • FLJ50214
    • FLJ52277
    • Follistatin like 1
    • Follistatin related protein
    • Follistatin-like protein 1
    • Follistatin-related protein 1
    • FRP
    • FSL1
    • FSTL1
    • FSTL1 antibody
    • FSTL1_HUMAN
    • Micro RNA 198
    • MIR198
    • miRNA198 included
    • OCC 1
    • OCC1
    see all
  • Function

    May modulate the action of some growth factors on cell proliferation and differentiation. Binds heparin.
  • Tissue specificity

    Overexpressed in synovial tissues from rheumatoid arthritis.
  • Sequence similarities

    Contains 2 EF-hand domains.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab191942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up