Recombinant human FSTL1/FRP protein (Active) (ab245801)

Description

  • Product name

    Recombinant human FSTL1/FRP protein (Active)
    See all FSTL1/FRP proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. When ab245801 is coated at 200 ng/well, the concentration of recombinant human BMP-4 that produces 50% of the optimal binding response is found to be approximately 250 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    > 95 % by HPLC.
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLK FVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLK CLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGK NQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTKEI
    • Predicted molecular weight

      33 kDa
    • Amino acids

      21 to 308
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab245801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Due to glycosylation, protein migration occurs at an apparent molecular weight of approximately 50-55 kDa by SDS-PAGE analysis under both reducing and non-reducing conditions.

     This product was previously labelled as FSTL1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1-1.0 mg/ml.

General Info

  • Alternative names

    • Anti FSTL1
    • FLJ50214
    • FLJ52277
    • Follistatin like 1
    • Follistatin related protein
    • Follistatin-like protein 1
    • Follistatin-related protein 1
    • FRP
    • FSL1
    • FSTL1
    • FSTL1 antibody
    • FSTL1_HUMAN
    • Micro RNA 198
    • MIR198
    • miRNA198 included
    • OCC 1
    • OCC1
    see all
  • Function

    May modulate the action of some growth factors on cell proliferation and differentiation. Binds heparin.
  • Tissue specificity

    Overexpressed in synovial tissues from rheumatoid arthritis.
  • Sequence similarities

    Contains 2 EF-hand domains.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab245801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up