Overview

  • Product name

    Recombinant Human FTSJ1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA APGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKE IIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPG GCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYD PPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSY PLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRV DTFPQPLAAPQCHTLLAPEMEDNEMSCSP
    • Amino acids

      1 to 329
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDLIV
    • FTSJ 1
    • FtsJ homolog 1
    • FtsJ homolog 1 (E. coli)
    • FtsJ RNA methyltransferase homolog 1
    • FTSJ1
    • JM23
    • Mental retardation X linked 44
    • Mental retardation X linked 9
    • MRX44
    • MRX9
    • Protein ftsJ homolog 1
    • Putative ribosomal RNA methyltransferase 1
    • RRMJ1
    • RRMJ1_HUMAN
    • rRNA (uridine 2' O ) methyltransferase
    • rRNA (uridine-2''-O-)-methyltransferase
    • SPB1
    • TRM7
    see all
  • Tissue specificity

    Found in fetal brain, lung, liver and kidney. In the adult brain, expressed in amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus.
  • Involvement in disease

    Defects in FTSJ1 are the cause of mental retardation X-linked type 44 (MRX44) [MIM:309549]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. RlmE family.
  • Information by UniProt

Images

  • ab161768 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up