Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPPIGNQLGALVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCK IQIASESSGIPERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDIDS NSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADK PLRITGDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSV PRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPEYYRQQVAFYGQT LGQAQAHSQEQ
    • Amino acids

      1 to 261
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Far upstream element (FUSE) binding protein 3
    • Far upstream element binding protein 3
    • Far upstream element-binding protein 3
    • FBP3
    • FLJ25229
    • FUBP 3
    • FUBP3
    • FUBP3_HUMAN
    • FUSE binding protein 3
    • FUSE-binding protein 3
    • OTTHUMP00000022369
    see all
  • Function

    May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression.
  • Tissue specificity

    Detected in a number of cell lines.
  • Sequence similarities

    Contains 4 KH domains.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab160271 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up