Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAIL GATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNV
    • Amino acids

      368 to 466
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha L fucosidase 2
    • Alpha L fucosidase fucohydrolase 2
    • Alpha-L-fucosidase 2
    • Alpha-L-fucoside fucohydrolase 2
    • dJ20N2.5
    • FUCA 2
    • FUCA2
    • FUCO2
    • FUCO2_HUMAN
    • Fucosidase alpha L 2 plasma
    • Fucosidase, alpha-L, plasma
    • MGC1314
    • Plasma alpha L fucosidase
    • Plasma alpha-L-fucosidase
    • RP1 20N2.5
    see all
  • Function

    Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 29 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab158475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up