Description

  • Product name

    Recombinant human FUK protein
  • Biological activity

    Specific Activity: ≥85.3 pmole/min/µg

    Assay Conditions: The reaction mixture contained 50 mM Tris-HCl, pH 8.0, 5 mM MgCl2, 2 mM L-Fucose, 100 μM ATP, and various amount of fucokinase in a final volume of 50 μL. The reaction was incubated at 37°C for 1 hr, and the amount of ATP consumed was calculated.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDYKDDDDKEQPKGVDWTVIILTCQYKDSVQVFQRELEVRQKREQIPAGT LLLAVEDPEKRVGSGGATLNALLVAAEHLSARAGFTVVTSDVLHSAWILI LHMGRDFPFDDCGRAFTCLPVENPEAPVEALVCNLDCLLDIMTYRLGPGS PPGVWVCSTDMLLSVPANPGISWDSFRGARVIALPGSPAYAQNHGVYLTD PQGLVLDIYYQGTEAEIQRCVRPDGRVPLVSGVVFFSVETAERLLATHVS PPLDACTYLGLDSGARPVQLSLFFDILHCMAENVTREDFLVGRPPELGQG DADVAGYLQSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTL PGAPGAQIVHSQVEEQQLLAAGSSVVSCLLEGPVQLGPGSVLQHCHLQGP IHIGAGCLVTGLDTAHSKALHGRELRDLVLQGHHTRLHGSPGHAFTLVGR LDSWERQGAGTYLNVPWSEFFKRTGVRAWDLWDPETLPAEYCLPSARLFP VLHPSRELGPQDLLWMLDHQEDGGEALRAWRASWRLSWEQLQPCLDRAAT LASRRDLFFRQALHKARHVLEARQDLSLRPLIWAAVREGCPGPLLATLDQ VAAGAGDPGVAARALACVADVLGCMAEGRGGLRSGPAANPEWMRPFSYLE CGDLAAGVEALAQERDKWLSRPALLVRAARHYEGAGQILIRQAVMSAQHF VSTEQVELPGPGQWVVAECPARVDFSGGWSDTPPLAYELGGAVLGLAVRV DGRRPIGARARRIPEPELWLAVGPRQDEMTVKIVCRCLADLRDYCQPHAP GALLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGLGT SSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLM PGIKVGRSRAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLL QDVLRSWYARLPAVVQNAHSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQ KKLMAPGCEPLTVRRMMDVLAPHVHGQSLAGAGGGGFLYLLTKEPQQKEA LEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTCCPFP
    • Predicted molecular weight

      119 kDa including tags
    • Amino acids

      2 to 1084
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_145059

Specifications

Our Abpromise guarantee covers the use of ab198052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 20% Glycerol, 0.02% Potassium chloride, 0.05% DTT, 0.04% Tween, 0.64% Sodium chloride

    Also contaings 80 ng/µL DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 1110046B12Rik
    • FLJ39408
    • Fucokinase
    • FUK
    • FUK_HUMAN
    • L-fucose kinase
    see all
  • Function

    Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.
  • Sequence similarities

    Belongs to the GHMP kinase family.
  • Information by UniProt

Images

  • Specific activity of ab198052 was determined to be 85.3 pmol/min/μg

  • 4-20% SDS-PAGE of FUK using 2μg of ab198052.

References

ab198052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up