Overview

  • Product name
    Recombinant Human FUSIP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP RGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40 kDa SR repressor protein
    • 40 kDa SR-repressor protein
    • Anti TLS associated protein with SR repeats
    • arginine/serine-rich 13A
    • FUS interacting protein serine arginine rich 1
    • FUS interacting protein serine arginine rich 2
    • FUS interacting serine arginine rich protein 1
    • FUS-interacting serine-arginine-rich protein 1
    • FUSIP1
    • FUSIP2
    • NSSR
    • OTTHUMP00000015774
    • Serine arginine repressor protein 40 kDa
    • Serine/arginine-rich splicing factor 10
    • SFRS13
    • SFRS13A
    • Splicing factor
    • Splicing factor arginine serine rich 13
    • Splicing factor SRp38
    • SRp38
    • SRp40
    • SRrp40
    • SRS10_HUMAN
    • Srsf10
    • TASR
    • TASR1
    • TASR2
    • TLS associated protein TASR1
    • TLS associated protein TASR2
    • TLS associated protein with Ser Arg repeats
    • TLS associated protein with SR repeats
    • TLS associated serine arginine protein
    • TLS associated serine arginine protein 1
    • TLS associated serine arginine protein 2
    • TLS associated SR protein
    • TLS-associated protein with Ser-Arg repeats
    • TLS-associated protein with SR repeats
    • TLS-associated serine-arginine protein
    • TLS-associated SR protein
    see all
  • Function
    Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated. Fully dephosphorylated in mitosis and partially dephosphorylated on heat shock. Isoform 3 is phosphorylated on Ser-168.
  • Cellular localization
    Nucleus speckle. Cytoplasm.
  • Information by UniProt

Images

  • ab161147 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up