Description

  • Product name

    Recombinant Human FUT7 protein (denatured)
    See all FUT7 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSPRGTPAPQPTITILVWHWPFTDQPPEL PSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRG QPWVWASMESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPS PPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPLCAS CLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYE AFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDW RERFCAICDRYPHLPRSQVYEDLEGWFQA
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      37 to 342
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004470
  • Description

    Recombinant Human FUT7 protein

Specifications

Our Abpromise guarantee covers the use of ab180311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • 3)-fucosyltransferase
    • Alpha (1,3) fucosyltransferase
    • Alpha (1,3) fucosyltransferase 7
    • Alpha-(1
    • Fuc-TVII
    • Fucosyltransferase 7
    • Fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
    • Fucosyltransferase VII
    • FucT VII
    • FucT-VII
    • FUT7
    • FUT7_HUMAN
    • Galactoside 3 L fucosyltransferase
    • Galactoside 3-L-fucosyltransferase
    • Selectin ligand synthase
    see all
  • Function

    May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.
  • Tissue specificity

    Leukocytic/myeloid lineage cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 10 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180311 (3 µg).

References

ab180311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up