Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSN HRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
    • Amino acids
      11 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fracture callus 1 homolog
    • Fracture callus 1 homolog (rat)
    • Fracture callus protein 1
    • FxC1
    • Mitochondrial import inner membrane translocase subunit Tim10 B
    • Mitochondrial import inner membrane translocase subunit Tim9 B
    • OTTHUMP00000164584
    • OTTHUMP00000230720
    • TIM 10B
    • Tim10b
    • Tim9b
    • TIM9B_HUMAN
    • TIMM10B
    • Translocase of inner mitochondrial membrane 10 homolog B (yeast)
    see all
  • Function
    Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
  • Tissue specificity
    Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
  • Sequence similarities
    Belongs to the small Tim family.
  • Domain
    The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of FXC1/TIM10B from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab161994 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up