Description

  • Product name

    Recombinant Human FXYD2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRC GGNKKRRQINEDEP
    • Amino acids

      1 to 64
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Sodium potassium ATPase, gamma-1 polypeptide
    • ATP 1C
    • ATP1 C
    • ATP1 G1
    • ATP1C
    • ATP1G 1
    • ATP1G1
    • ATPase, Na+/K+ transporting, gamma 1 polypeptide
    • FXYD 2
    • FXYD domain containing ion transport regulator 2
    • Gamma subunit of sodium potassium ATPase
    • GNAKATP
    • HOMG 2
    • HOMG2
    • Hypomagnesemia 2, renal
    • Na(+)/K(+) ATPase subunit gamma
    • Sodium potassium ATPase, gamma polypeptide
    • Sodium pump gamma chain
    • Sodium/potassium-transporting ATPase gamma chain
    • sodium/potassium-transporting ATPase subunit gamma
    see all
  • Relevance

    FXYD2, also known as FXYD domain-containing ion transport regulator 2 or Na, K-ATPase gamma subunit, belongs to a family of small membrane proteins that all contain a characteristic FXYD domain. The FXYD domain is 35 amino acids long and starts with the sequence PFXYD. FYYD2 modulates the activity of the Na, K-ATPase. Although FYXD2 is not essential for Na, K-ATPase function, it is thought to induce its activity. In human foetal astrocyte cells, the glutamate transporter EAAT1/GLAST directs FXYD2 to the cell surface, resulting in activation of the astroglial Na, K-ATPase. Mutations in the gene encoding FXYD2 are associated with renal hypomagnesaemia.
  • Cellular localization

    Cell Membrane

Images

  • ab157928 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up