Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN NFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDL SFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYF GKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVK HYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMP RLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTL KPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLL DFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNG LICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS FGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIH CWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
    • Molecular weight

      61 kDa including tags
    • Amino acids

      2 to 537
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity: 200 pmole/min/µg.
    Assay Conditions: Enzyme reaction is conducted in a Kinase Buffer (50 mM Tris pH 7.4, 20 mM MgCl2, 0.1 mg/ml BSA and 1 mM DTT) containing 20 µM ATP and 0.2 mg/ml poly-(Glu-Tyr) for 30 min at 30 oC. Enzyme activity is measured using Kinase-Glo plus reagents.
  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.56% Glutathione, 0.019% Potassium chloride, 0.72% Tris HCl, 10% Glycerol, 0.73% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • C syn protooncogene
    • Fyn
    • FYN oncogene related to SRC FGR YES
    • FYN_HUMAN
    • OKT3 induced calcium influx regulator
    • P59 FYN
    • p59-Fyn
    • Protein tyrosine kinase fyn
    • Proto oncogene tyrosine protein kinase fyn
    • Proto-oncogene c-Fyn
    • Proto-oncogene Syn
    • Protooncogene Syn
    • SLK
    • Src like kinase
    • Src yes related novel gene
    • Src-like kinase
    • Src/yes related novel
    • SYN
    • Tyrosine kinase p59fyn T
    • Tyrosine kinase p59fyn(T)
    • Tyrosine-protein kinase Fyn
    see all
  • Function

    Tyrosine-protein kinase implicated in the control of cell growth. Plays a role in the regulation of intracellular calcium levels, with isoform 2 showing the greater ability to mobilize cytoplasmic calcium in comparison to isoform 1. Required in brain development and mature brain function with important roles in the regulation of axon growth, axon guidance, and neurite extension. Blocks axon outgrowth and attraction induced by NTN1 by phosphorylating its receptor DDC. Phosphorylates RUNX3.
  • Tissue specificity

    Isoform 1 is highly expressed in the brain. Isoform 2 is expressed in cells of hemopoietic lineages, especially T lymphocytes.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell membrane. Present and active in lipid rafts. Present in cell body and along the process of mature and developing oligodendroyctes.
  • Information by UniProt

Images

  • The specific activity of ab135007 is 200 pmole/min/ug.
  • 10% SDS-PAGE analysis of ab135007 at 4 µg stained with Coomassie Blue.

References

ab135007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up