Overview

  • Product name
    Recombinant Human FYTTD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNF PRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNG VITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQ RKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQ AQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRL TRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKE QRATLTYNKGGSRFVTVG
    • Amino acids
      1 to 318
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp761B1514
    • Forty two three domain containing 1
    • Forty two three domain containing protein 1
    • Forty-two-three domain-containing protein 1
    • FYTTD 1
    • fyttd1
    • OTTHUMP00000208028
    • OTTHUMP00000208031
    • OTTHUMP00000208032
    • Protein 40 2 3
    • Protein 40-2-3
    • UAP56 interacting factor
    • UAP56-interacting factor
    • UIF
    • UIF_HUMAN
    see all
  • Function
    Required for mRNA export from the nucleus to the cytoplasm. Acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Associates with spliced and unspliced mRNAs simultaneously with THOC4.
  • Sequence similarities
    Belongs to the UIF family.
  • Cellular localization
    Nucleus > nucleoplasm. Nucleus speckle.
  • Information by UniProt

Images

  • ab164533 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Savitski MM  et al. Multiplexed Proteome Dynamics Profiling Reveals Mechanisms Controlling Protein Homeostasis. Cell 173:260-274.e25 (2018). Read more (PubMed: 29551266) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up