Bioactive grade

Recombinant human G-CSF protein (Animal Free) (ab218087)

Description

  • Product name

    Recombinant human G-CSF protein (Animal Free)
    See all G-CSF proteins and peptides
  • Biological activity

    NFS-60 cell proliferation. ED50 ≤50 pg/ml; ≥ 2 x 107 units/mg (typical ED50 is 5-15 pg/ml).

  • Purity

    > 95 % SDS-PAGE.
    The purity of ab218087 is determined by Reducing and Non-reducing SDS-PAGE.
  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL LGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPEL GPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAG GVLVASHLQSFLEVSYRVLRHLAQP
    • Predicted molecular weight

      19 kDa
    • Amino acids

      31 to 204

Associated products

Specifications

Our Abpromise guarantee covers the use of ab218087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilised from a sterile (0.2 micron) filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • C17orf33
    • Colony stimulating factor 3
    • Colony stimulating factor 3 (granulocyte)
    • CSF 3
    • CSF beta
    • CSF3
    • CSF3_HUMAN
    • CSF3OS
    • Csfg
    • Filgrastim
    • G-CSF
    • GCSA
    • GCSF
    • Granulocyte colony stimulating factor
    • Granulocyte colony-stimulating factor
    • Lenograstim
    • Macrophage granulocyte inducer 2
    • MGC45931
    • MGI 2
    • Pluripoietin
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications

    O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab218087
  • 4-20% Tris-glycine SDS-PAGE analysis of 1 μg ab218087.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    Stained with Coomassie blue.

References

ab218087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up