Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSD PLLIGIPTSENPFKDKKT
    • Amino acids
      1 to 68
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G-protein gamma-12 subunit
    • GNG12
    • Guanine nucleotide binding protein (G protein) gamma 12
    • guanine nucleotide-binding protein G(I)/G(S)/G(O)
    • Hypothetical protein DKFZp762E193
    see all
  • Relevance
    G gamma12 has signal transducer activity in G-protein coupled receptor protein signaling pathway.
  • Cellular localization
    Cell Membrane

Images

  • ab163286 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up