Description

  • Product name

    Recombinant Human G gamma12 protein (denatured)
    See all G gamma12 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSSKTASTNNIAQARRTVQQLRLEASI ERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTC
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      1 to 69
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 1 to 69. The propeptide is not included (NP_061329).
  • Description

    Recombinant Human G gamma12 protein

Specifications

Our Abpromise guarantee covers the use of ab202183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • G-protein gamma-12 subunit
    • GNG12
    • Guanine nucleotide binding protein (G protein) gamma 12
    • guanine nucleotide-binding protein G(I)/G(S)/G(O)
    • Hypothetical protein DKFZp762E193
    see all
  • Relevance

    G gamma12 has signal transducer activity in G-protein coupled receptor protein signaling pathway.
  • Cellular localization

    Cell Membrane

Images

  • 15% SDS-PAGE analysis of ab202183 (3 μg).

References

ab202183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up