Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMKEGMSNNSTTSISQARKAVEQLKMEA CMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFC
    • Molecular weight
      10 kDa including tags
    • Amino acids
      1 to 72
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab177602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab177602 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • GNG4
    • GNGT4
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-4 subunit
  • Relevance
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G gamma4 interacts with beta-1 and beta-2, but not with beta-3. It is expressed in brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle.

Images

  • 15% SDS-PAGE analysis of ab177602 (3µg).

References

ab177602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up