Description

  • Product name

    Recombinant Human G6b protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSF PACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSA GDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGA GLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
    • Amino acids

      1 to 237
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as C6orf25.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C6orf25
    • Chromosome 6 open reading frame 25
    • G6b
    • G6b B
    • G6B protein
    • Immunoglobulin receptor
    • Megakaryocyte and platelet inhibitory receptor G6b
    • MGC142279
    • MGC142281
    • MPIG6B
    • NG31
    • Protein G6b
    • THAMY
    see all
  • Relevance

    G6b is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. It is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Isoforms A and B: Cell membrane; Single-pass type I membrane protein. Isoforms D and E: Endoplasmic reticulum. Golgi apparatus.

Images

  • ab164283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up