Overview

  • Product name

    Recombinant Human G9P protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVP ELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTG LYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAV PSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNP SSSWPSPTEPSFKTGIARHLHVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      22 to 242
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab151352 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.

    Previously labelled as KIR2DL4. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • CD_antigen=CD158d
    • CD158 antigen like family member D
    • CD158 antigen-like family member D
    • CD158d
    • G9P
    • KI2L4_HUMAN
    • Killer cell immunoglobulin like receptor 2DL4
    • Killer cell immunoglobulin like receptor, two domains, long cytoplasmic tail, 4
    • Killer cell immunoglobulin-like receptor 2DL4
    • Killer cell inhibitory receptor 103AS
    • Killer Ig receptor
    • KIR 103AS
    • KIR-103AS
    • KIR103
    • KIR103AS
    • KIR2DL4
    • MHC class I NK cell receptor KIR103AS
    • Natural killer cell inhibitory receptor
    • NK cell receptor
    • NK cell receptor; natural killer cell inhibitory receptor
    • OTTHUMP00000068612
    • OTTHUMP00000068614
    • OTTHUMP00000068615
    see all
  • Function

    Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab151352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up