Description

  • Product name

    Recombinant Human GAA1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGLLSDPVRRRALARLVLRLNAPLCVLSYVAGIAWFLALVFPPLTQRTYM SENAMGSTMVEEQFAGGDRARAFARDFAAHRKKSGALPVAWLERTMQSVG LEVYTQSFSRKLPFPDETHERYMVSGTNVYGILRAPRAASTESLVLTVPC GSDSTNSQAVGLLLALAAHFRGQIYWAKDIVFLVTEHDLLGTEAWLEAYH DVNVTGMQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLD LLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPLQGLQTLLLMVLRQASG RPHGSHGLFLRYRVEALTLRGINSFRQYKYDLVAVGKALEGMFRKLNHLL ERLHQSFFLYLLPGLSRFVSIGLYMPAVGFLLLVLGLKALELWMQLHEAG MGLEEPGGAPGPSVPLPPSQGVGLASLVAPLLISQAMGLALYVLPVLGQH VATQHFPVAEAEAVVLTLLAIYAAGLALPHNTHRVVSTQAPDRGWMALKL VALIYLALQLGCIALTNFSLGFLLATTMVPTAALAKPHGPRTLYAALLVL TSPAATLLGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLF PLLSLGLYPCWLLFWNVLFWK
    • Amino acids

      1 to 621
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GPAA1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Anchor attachment protein 1 (Gaa1p, yeast) homolog
    • GAA1
    • GAA1 protein homolog
    • Glycophosphatidylinositol anchor attachment 1
    • Glycosylphosphatidylinositol anchor attachment 1 protein
    • Glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
    • GPAA 1
    • GPAA1
    • GPAA1_HUMAN
    • GPAA1P anchor attachment protein 1 homolog
    • GPI anchor attachment protein 1
    • GPI transamidase subunit
    • hGAA1
    see all
  • Function

    Essential for GPI-anchoring of precursor proteins but not for GPI synthesis. Acts before or during formation of the carbonyl intermediate.
  • Tissue specificity

    Ubiquitously expressed in fetal and adult tissues. Expressed at higher levels in fetal tissues than adult tissues.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab160167 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up