Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYK NDHSKKPLRIINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAE TEEDMNKWVQSICQICGFNQAEESTDSLRNVSSAGHGPRSSPAELSSSSQ HLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCIS RRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYS LPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIA PPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRL HRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSED NYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLGYPSTTLPVHR GPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWS RANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEK TQALQNTMQEWTDVRQSSEPSKGAKL
    • Amino acids
      1 to 676
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAB 2
    • Gab2
    • GAB2_HUMAN
    • Grb 2 associated binder 2
    • GRB 2 associated binding protein 2
    • Grb2 associated binder 2
    • GRB2 associated binder 2 pp100
    • GRB2 associated binding protein 2
    • GRB2-associated binder 2
    • GRB2-associated-binding protein 2
    • Growth factor receptor bound protein 2 associated protein 2
    • Growth factor receptor bound protein 2-associated protein 2
    • KIAA0571
    • p97
    • PH domain containing adaptor molecule p97
    • pp100
    see all
  • Function
    Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF11A/RANK signaling. In allergic response, it plays a role in mast cells activation and degranulation through PI-3-kinase regulation. Also involved in the regulation of cell proliferation and hematopoiesis.
  • Sequence similarities
    Belongs to the GAB family.
    Contains 1 PH domain.
  • Domain
    The SH3-binding motifs mediate interaction with SHC1 and GRB2.
    The PH domain mediates phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,4-bisphosphate binding.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residue(s) by the thrombopoietin receptor (TPOR), stem cell factor receptor (SCFR), and T-cell and B-cell antigen receptors, gp130, IL-2R and IL-3R (By similarity). Phosphorylated upon stimulation of TNFRSF11A/RANK by TNFSF11/RANKL (By similarity). Phosphorylated upon EGF stimulation. Phosphorylated on tyrosine residues by HCK upon IL6 signaling.
    Dephosphorylated by PTPN11.
  • Cellular localization
    Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • ab160681 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up