Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFT RILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFF RQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPN KLPRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSE VVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAH FHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA WDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNT TSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYLN REPVIKGAASPK
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 462

Specifications

Our Abpromise guarantee covers the use of ab152412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as GABA A Receptor alpha 5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GAA 5
    • GAA5
    • GABA(A) receptor subunit alpha-5
    • GABRA 5
    • Gabra5
    • Gamma aminobutyric acid GABA A receptor alpha 5
    • Gamma aminobutyric acid GABA A receptor alpha 5 precursor
    • Gamma aminobutyric acid receptor alpha 5 subunit precursor GABA A receptor
    • Gamma-aminobutyric acid receptor subunit alpha-5
    • GBRA5_HUMAN
    • GC138184
    see all
  • Function

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA5 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152412 stained with Coomassie Blue.

References

ab152412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up