Description

  • Product name

    Recombinant Human GABARAP protein (Fc Chimera)
    See all GABARAP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVP VIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGLVDDIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 117
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Fused with a FC tag at the C terminus.

Specifications

Our Abpromise guarantee covers the use of ab191929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 7.00
    Constituents: 20% Glycerol, 0.87% Sodium chloride, 79% Phosphate Buffer

General Info

  • Alternative names

    • ATG8A
    • FLC 3B
    • FLC3B
    • FLJ25768
    • GABA type A receptor associated protein
    • GABA(A) receptor associated protein
    • GABA(A) receptor-associated protein
    • GABARAP
    • GABARAP a
    • Gamma aminobutyric acid receptor associated protein
    • Gamma-aminobutyric acid receptor-associated protein
    • GBRAP_HUMAN
    • MGC120154
    • MGC120155
    • MM 46
    • MM46
    see all
  • Function

    Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Tissue specificity

    Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the ATG8 family.
  • Post-translational
    modifications

    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAP-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAP-II.
  • Cellular localization

    Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae. Colocalizes with microtubules (By similarity). Localizes also to discrete punctae along the ciliary axoneme (By similarity).
  • Information by UniProt

References

ab191929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up