Description

  • Product name

    Recombinant Human GABARAPL1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab101641 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVP VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV NNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 117
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • APG8 like
    • APG8L
    • ATG8
    • ATG8B
    • ATG8L
    • Early estrogen regulated protein
    • Early estrogen-regulated protein
    • GABA
    • GABA(A) receptor associated protein like 1
    • GABA(A) receptor-associated protein-like 1
    • GABARAPL1
    • GABARAPL1 a
    • Gamma aminobutyric acid receptor associated protein like 1
    • Gamma-aminobutyric acid receptor-associated protein-like 1
    • GBRL1_HUMAN
    • GEC 1
    • GEC-1
    • GEC1
    • Glandular epithelial cell protein 1
    see all
  • Function

    Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Tissue specificity

    Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.
  • Sequence similarities

    Belongs to the ATG8 family.
  • Post-translational
    modifications

    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes.
    The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasmic vesicle membrane. Endoplasmic reticulum. Golgi apparatus. Cytoplasmic vesicle > autophagosome.
  • Information by UniProt

Images

  • ab101641 at 3 µg analysed by 15% SDS PAGE.

References

ab101641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up