Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH YSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAK DMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNE DLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSE NSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEE VVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREAL QKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 395

Specifications

Our Abpromise guarantee covers the use of ab132893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

     This product was previously labelled as GABPB2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BABPB2
    • E4TF1
    • E4TF1-47
    • E4TF1-53
    • E4TF1B
    • GA binding protein transcription factor beta subunit 1 transcript variant gamma 2
    • GA binding protein transcription factor, beta subunit 1
    • GA binding protein transcription factor, beta subunit 2
    • GA-binding protein subunit beta-1
    • GABP subunit beta-1
    • GABP subunit beta-2
    • GABP1_HUMAN
    • GABPB
    • GABPB-1
    • GABPB-2
    • GABPB1
    • GABPB2
    • NRF2B1
    • NRF2B2
    • Nuclear respiratory factor 2
    • Transcription factor E4TF1-47
    • Transcription factor E4TF1-53
    see all
  • Function

    Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
  • Sequence similarities

    Contains 5 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132893 stained with Coomassie Blue.

References

ab132893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up