Description

  • Product name

    Recombinant Human GABPB2/Nuclear respiratory factor 2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab204765 was purified by 6x His tag / Immobilized-metal affinity chromatography (IMAC).
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH YSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAK DMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNE DLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSE NSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS SETPVVAT EEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPII VTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEERE ALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 395
    • Additional sequence information

      NM_005254.5.

Specifications

Our Abpromise guarantee covers the use of ab204765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Mass Spectrometry

    SDS-PAGE

    ELISA

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as GABPB2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 3.4% Imidazole
    Constituents: 2.9% Sodium chloride, 0.24% Tris

General Info

  • Alternative names

    • BABPB2
    • E4TF1
    • E4TF1-47
    • E4TF1-53
    • E4TF1B
    • GA binding protein transcription factor beta subunit 1 transcript variant gamma 2
    • GA binding protein transcription factor, beta subunit 1
    • GA binding protein transcription factor, beta subunit 2
    • GA-binding protein subunit beta-1
    • GABP subunit beta-1
    • GABP subunit beta-2
    • GABP1_HUMAN
    • GABPB
    • GABPB-1
    • GABPB-2
    • GABPB1
    • GABPB2
    • NRF2B1
    • NRF2B2
    • Nuclear respiratory factor 2
    • Transcription factor E4TF1-47
    • Transcription factor E4TF1-53
    see all
  • Function

    Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
  • Sequence similarities

    Contains 5 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab204765 with a 6x His tag. The gel was stained with Coomassie Blue.

References

ab204765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up