Overview

  • Product name

    Recombinant Human GABRB1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSE VNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDK KSFVHGVTV
    • Molecular weight

      38 kDa including tags
    • Amino acids

      28 to 136

Specifications

Our Abpromise guarantee covers the use of ab152415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as GABA A Receptor beta 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AW061132
    • B230208N19Rik
    • GABA(A) receptor beta 1
    • GABA(A) receptor subunit beta-1
    • GABA-A receptor, beta-1 polypeptide
    • Gabrb-1
    • GABRB1
    • Gamma aminobutyric acid (GABA) A receptor beta 1
    • Gamma Aminobutyric Acid A Receptor Beta 1
    • Gamma Aminobutyric Acid Receptor , beta-1
    • Gamma-aminobutyric acid (GABA) A receptor, subunit beta 1
    • Gamma-aminobutyric acid receptor subunit beta-1
    • GARB1
    • GBRB1_HUMAN
    see all
  • Function

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB1 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152415 stained with Coomassie Blue.

References

ab152415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up