Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYG DAEKPAESGGSQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPA CDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELA DQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTA NTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYA MMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVI LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGV PLQCSALLVREEGLMQNCNQ MHASYLFQQDKHYDLSYDTGDKALQCGR HVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGK PQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQ PLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
    • Molecular weight

      65 kDa
    • Amino acids

      1 to 585
    • Additional sequence information

      Recombinant human GAD65 expressed in baculoviral infection of Spodoptera frugiperda cells, purified & formulated in RPMI medium in human serum albumin (clinical grade) for use in T cell assays.

Specifications

Our Abpromise guarantee covers the use of ab206646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: Human serum albumin, 0.03% DTT

    RPMI buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 65 kDa glutamic acid decarboxylase
    • DCE 2
    • DCE2
    • DCE2_HUMAN
    • GAD 2
    • GAD 65
    • GAD-2
    • GAD-65
    • Gad2
    • Glutamate decarboxylase 2
    • Glutamate decarboxylase 2 (pancreas)
    • Glutamate Decarboxylase 2 (pancreatic islets and brain 65kDa)
    • Glutamate Decarboxylase 65
    • Glutamate decarboxylase 65 kDa isoform
    • Glutamic Acid Decarboxylase 2
    • Glutamic Acid Decarboxylase 65
    • MGC161605
    • MGC161607
    see all
  • Function

    Catalyzes the production of GABA.
  • Sequence similarities

    Belongs to the group II decarboxylase family.
  • Post-translational
    modifications

    Phosphorylated; which does not affect kinetic parameters or subcellular location.
    Palmitoylated; which is required for presynaptic clustering.
  • Cellular localization

    Cytoplasm > cytosol. Cytoplasmic vesicle. Cell junction > synapse > presynaptic cell membrane. Golgi apparatus membrane. Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of Golgi membranes and presynaptic clusters.
  • Information by UniProt

Images

  • SDS Page Gel analysis comparing different protein molecular weights, lanes 1 & 2 contain rhGAD65 ab206647 at concentrations of 1 µL & 0.1 µL respectively. This protein was compared to BSA (lane 3 - 1 µg & lane 4 - 10 µg) and T-cell GAD65 (ab206646) (lane 5 - 1 µL & lane 6 - 0.1 µL). The bands were run on a NuPAGE 7% Tris-Acetate Gel.

References

ab206646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up