Overview

  • Product name

    Recombinant Human GADD34 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAV KGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKT
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Apoptosis associated protein
    • GADD 34
    • Growth arrest and DNA damage inducible 34
    • Growth arrest and DNA damage-inducible protein GADD34
    • Myeloid differentiation primary response protein MyD116 homolog
    • Ppp1r15a
    • PR15A_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 15A
    • Protein phosphatase 1 regulatory subunit 15A
    see all
  • Function

    Recruits the serine/threonine-protein phosphatase PP1 to dephosphorylate the translation initiation factor eIF-2A/EIF2S1, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. Down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 by PP1. May promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'.
  • Sequence similarities

    Belongs to the PPP1R15 family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine by LYN; which impairs its antiproliferative activity.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab153242 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up