Recombinant Human GADD45B protein (ab172168)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTLEELVACDNAAQKMQTVTAAVEELLVAA QRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQS FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW KSHGLVEVASYCEESRGNNQWVPYISLQER
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 160
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

General Info

  • Alternative names
    • GA45B_HUMAN
    • GADD45 Beta
    • Gadd45b
    • GADD45BETA
    • Growth arrest and DNA damage inducible 45 beta
    • Growth arrest and DNA damage inducible beta
    • Growth arrest and DNA damage-inducible gene GADD45, beta
    • Growth arrest and DNA damage-inducible protein GADD45 beta
    • Growth arrest and DNA-damage-inducible protein GADD45 beta
    • MY118
    • MYD118
    • MYD118, mouse, homolog of
    • Myeloid differentiation primary response gene
    • Myeloid differentiation primary response protein MyD118
    • Negative growth regulatory protein MyD118
    • Negative growth-regulatory protein MyD118
    see all
  • Function
    Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
  • Sequence similarities
    Belongs to the GADD45 family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172168.

    Lane 1: Reduced

    Lane 2: Non-Reduced

References

ab172168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up