Description

  • Product name

    Recombinant Human Galanin protein
  • Purity

    > 90 % SDS-PAGE.
    ab156743 is purified by anion-exchange and gel-filtration chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSASAGLWSPAKEKRGWTLNSAGYLLGPH AVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSF LHLKEAGALDRLLDLPAAASSEDIERS
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      20 to 123
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • GAL
    • GAL 1
    • GAL GMAP
    • GAL1
    • GALA_HUMAN
    • Galanin message associated peptide
    • Galanin message-associated peptide
    • Galanin precursor
    • Galanin prepropeptide
    • Galanin related peptide
    • Galanin/GMAP prepropeptide
    • GALN
    • GLNN
    • GMAP
    • MGC40167
    see all
  • Function

    Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion.
  • Sequence similarities

    Belongs to the galanin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156977 (3µg).

References

ab156977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up