Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKN GWAAIGTHSFEFAQFDNFLVEATR
    • Amino acids
      596 to 669
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as Galactosylceramidase.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gacy
    • Galactocerebrosidase
    • Galactocerebroside beta galactosidase
    • Galactocerebroside beta-galactosidase
    • Galactosylceramidase
    • Galactosylceramide beta galactosidase
    • Galactosylceramide beta-galactosidase
    • galactosylceraminidase
    • GALC
    • GALC_HUMAN
    • GALCERase
    • Twitcher
    see all
  • Function
    Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
  • Tissue specificity
    Detected in urine. Detected in testis, brain and placenta (at protein level). Detected in kidney and liver.
  • Involvement in disease
    Leukodystrophy, globoid cell
  • Sequence similarities
    Belongs to the glycosyl hydrolase 59 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • ab158489 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up