Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRF NAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVK LPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
    • Molecular weight

      15 kDa
    • Amino acids

      1 to 135
    • Additional sequence information

      This product is the mature full length protein from aa 1 to 135.

Specifications

Our Abpromise guarantee covers the use of ab222363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituent: 0.16% Sodium phosphate

    Lyophilized from a sterile 0.2 micron filtered solution

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • 14 kDa laminin-binding protein
    • 14 kDa lectin
    • Beta galactoside binding lectin
    • Beta galactoside binding lectin L 14 I
    • beta galactoside binding protein
    • Beta-galactoside-binding lectin L-14-I
    • DKFZp686E23103
    • Gal 1
    • Gal-1
    • GAL1
    • Galaptin
    • Galbp
    • Galectin
    • Galectin-1
    • Galectin1
    • GBP
    • HBL
    • HLBP14
    • HPL
    • L 14.5
    • L-14.5
    • L14
    • Lactose binding lectin 1
    • Lactose-binding lectin 1
    • Lect14
    • Lectin galactoside binding soluble 1
    • Lectin galactoside-binding soluble 1
    • LEG1_HUMAN
    • LGALS 1
    • LGALS1
    • Lgals1 lectin galactose binding soluble 1
    • MAPK activating protein MP12
    • Putative MAPK activating protein MP12
    • Putative MAPK-activating protein PM12
    • S Lac lectin 1
    • S-Lac lectin 1
    see all
  • Function

    May regulate apoptosis, cell proliferation and cell differentiation. Binds beta-galactoside and a wide array of complex carbohydrates. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase.
  • Tissue specificity

    Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in amnion, chorioamniotic mesenchyma and chorion (at protein level). Expressed in cardiac, smooth, and skeletal muscle, neurons, thymus, kidney and hematopoietic cells.
  • Sequence similarities

    Contains 1 galectin domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 1 µg ab222363 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    ab222363 has a predicted weight of 14.5 kDa.

  • ab222363 induced chemotaxis of THP-1 (human monocytic leukemia cell line) cells.

References

ab222363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up