Description

  • Product name

    Recombinant Human Galectin 7 protein
    See all Galectin 7 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab182800 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSNVPHKSSLPEGIRPGTVLRI RGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGR EERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLV EVGGDVQLDSVRIF
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      2 to 136
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Mature protein; codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_002298.

Specifications

Our Abpromise guarantee covers the use of ab182800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituent: 0.32% Tris HCl

    Buffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • Gal-7
    • GAL7
    • Galectin 7B
    • Galectin-7
    • HKL-14
    • Human keratinocyte lectin 14
    • Keratinocyte lectin 14
    • Lectin galactoside binding soluble 7
    • Lectin, galactoside binding, soluble, 7B
    • LEG7_HUMAN
    • LGALS7
    • LGALS7A
    • LGALS7B
    • P53 induced protein 1
    • p53-induced gene 1 protein
    • Pi7
    • PIG1
    • TP53I1
    see all
  • Function

    Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
  • Tissue specificity

    Mainly expressed in stratified squamous epithelium.
  • Sequence similarities

    Contains 1 galectin domain.
  • Cellular localization

    Cytoplasm. Nucleus. Secreted. May be secreted by a non-classical secretory pathway.
  • Information by UniProt

References

ab182800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up