Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYG EPSRETPNLDRMAAEGLLFPNFYSANPLCSPSRAALLTGRLPIRNGFYTT NAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFH PLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKT GEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQ RGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQG GSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKA HFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGE RFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPG CEKLGKCLTPPESIPKKCLWSH
    • Amino acids

      1 to 522
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as GALNS

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chondroitinase
    • Chondroitinsulfatase
    • FLJ00319
    • FLJ17434
    • FLJ42844
    • FLJ98217
    • Galactosamine (N acetyl) 6 sulfate sulfatase
    • Galactose 6 sulfate sulfatase
    • GALNAC6S
    • GalNAc6S sulfatase
    • GALNS6
    • GAS
    • mFLJ00319
    • MPS4A
    • N acetylgalactosamine 6 sulfatase
    • N acetylgalactosamine 6 sulfate sulfatase
    see all
  • Relevance

    GALNS (N-acetylgalactosamine-6-sulfatase) is a lysosomal exohydrolase which catalyzes the hydrolysis of the 6-sulfate groups of the N-acetyl-D-galactosamine 6-sulfate units of chondroitin sulfate and of the D-galactose 6-sulfate units of keratan sulfate. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder.
  • Cellular localization

    Lysosome

Images

  • ab158492 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up