Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDA GERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQ
    • Amino acids
      43 to 138
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C10199
    • EC 2.4.1.41
    • GalNAc T3
    • GalNAc transferase 3
    • GalNAc-T3
    • GalNAcT3
    • GALNT3
    • GALT3_HUMAN
    • HFTC
    • HHS
    • MGC61909
    • OTTHUMP00000204915
    • OTTHUMP00000204919
    • Polypeptide GalNAc transferase 3
    • Polypeptide GalNAc transferase T3
    • Polypeptide N acetylgalactosaminyltransferase 3
    • Polypeptide N-acetylgalactosaminyltransferase 3
    • pp-GaNTase 3
    • ppGaNTase 3
    • Protein UDP acetylgalactosaminyltransferase 3
    • Protein-UDP acetylgalactosaminyltransferase 3
    • RP23-306G16.2
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 3
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 3 (GalNAc T3)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5. Probably glycosylates fibronectin in vivo. Glycosylates FGF23. Plays a central role in phosphate homeostasis.
  • Tissue specificity
    Expressed in organs that contain secretory epithelial glands. Highly expressed in pancreas, skin, kidney and testis. Weakly expressed in prostate, ovary, intestine and colon. Also expressed in placenta and lung and fetal lung and fetal kidney.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Defects in GALNT3 are a cause of hyperphosphatemic familial tumoral calcinosis (HFTC) [MIM:211900]. HFTC is a severe autosomal recessive metabolic disorder that manifests with hyperphosphatemia and massive calcium deposits in the skin and subcutaneous tissues. Some patients manifest recurrent, transient, painful swellings of the long bones associated with the radiographic findings of periosteal reaction and cortical hyperostosis and absence of skin involvement.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Resides preferentially in the trans and medial parts of the Golgi stack.
  • Information by UniProt

Images

  • ab158495 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up