Description

  • Product name

    Recombinant Human GALNT4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RARELGSRRLSGLQKNTEDLSRPLYKKPPADSRALGEWGKASKLQLNEDE LKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQKFNYRTLPTTSV IIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETY ISNLDRVRLIRTNKREGLVRARLIGATFATGDVLTFLDCHCECNSGWLEP LLERIGRDETAVVCPVIDTIDWNTFEFYMQIGEPMIGGFDWRLTFQWHSV PKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENL ELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDE YKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFPNLHVPE DRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQFFEYT SNKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTI FHPHSGLCLSAYRTPEGRPDVQMRTCDALDKNQIWSFEK
    • Amino acids

      40 to 578
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 2.4.1.41
    • GALNAC T4
    • GalNAc transferase 4
    • GalNAc-T4
    • GalNAcT4
    • GALNT4
    • GALT4_HUMAN
    • N-acetylgalactosaminyltransferase 4 (GalNAc-T4)
    • Polypeptide GalNAc transferase 4
    • Polypeptide N-acetylgalactosaminyltransferase 4
    • pp GaNTase 4
    • pp-GaNTase 4
    • Protein UDP acetylgalactosaminyltransferase 4
    • Protein-UDP acetylgalactosaminyltransferase 4
    • UDP GalNAc:polypeptide N-acetylgalactosaminyltransferase 4
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide
    see all
  • Function

    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a highest activity toward Muc7, EA2 and Muc2, with a lowest activity than GALNT2. Glycosylates 'Thr-57' of SELPLG.
  • Tissue specificity

    Ubiquitous. Highly expressed in mucous cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain directs the glycopeptide specificity. It is required in the glycopeptide specificity of enzyme activity but not for activity with naked peptide substrates, suggesting that it triggers the catalytic domain to act on GalNAc-glycopeptide substrates.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160144 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up